يتم الاحتفاظ بمحتوى الأدلة باللغة الإنجليزية.

تصوير الهيكل المثالي لـ LL-37

المطابق المثالي المبني من التسلسل؛ ليست بنية تجريبية أو متوقعة.

لمحة سريعة

ENTRY TYPE
endogenous
IDENTITY
Sequence verified

No structure asset recorded

TOP EVIDENCE
Grade B — Venous leg ulcer healing
MAJOR STATUS
Jurisdiction-specific — see status table
SPORT
Prohibited — as of 2026-08-06
VERIFIED
2026-08-06

Bottom line

LL-37 is the only human cathelicidin, a 37-residue antimicrobial peptide encoded by the CAMP gene. It has broad-spectrum antimicrobial, immunomodulatory, and wound-healing activities. A Phase 1/2 (LL-37001B, n=34) found topical LL-37 accelerated healing of hard-to-heal venous leg ulcers, with the lowest dose showing a sixfold healing rate improvement vs . A Phase 2b trial (LL-37002) has been completed. No LL-37 product has received regulatory approval.

Identity and composition

FieldVerified information
Preferred nameLL-37
Key aliasesCathelicidin antimicrobial peptide, hCAP18, CAP-18, FALL-39, Ropocamptide
Molecular/sequence identity37-residue peptide: [LL-37, 37 aa]
Modifications/formC-terminal cleavage product of hCAP18; amphipathic α-helical conformation; MW ~4,493 Da
Stable identifiersUniProt P49913; 16198951; CAS 154947-66-7; ChEMBL530345; DrugBank DB16532
Identity caveatsActive form is cleaved from the 170-aa hCAP18 precursor. Truncated fragments (RK-31, KS-30, KR-20, FK-13, KR-12) occur naturally and have varying activities.

Development and approval status

JurisdictionStatus and indicationProduct/sourceAs of
United States (FDA)Not approved for any indicationN/A2026-08-06
European Union (EMA); Phase 2 trials completed (LL-37001B, LL-37002)N/A2026-08-06
Other jurisdictionsStatus of synthetic products requires current national-register review; status is not product authorization2026-08-06
Status is multi-axis
LL-37 authorization and sport-status profileFour medicine-authorization axes reproduce only documented status rows; sport status is shown separately.UNITED STATESNot approved for any indicationSOURCE / AS OFROW 1 / 2026-08-06EU/EEAInvestigational; Phase 2 trialscompleted (LL-37001B, LL-37002)SOURCE / AS OFROW 2 / 2026-08-06UNITED KINGDOMSOURCE ROW OMITTEDSEE AUDIT REASONSOURCE / AS OFNOT PRESENT / NOT RECORDEDOTHER DOCUMENTEDStatus of synthetic productsrequires currentSOURCE / AS OFROW 3 / 2026-08-06SPORT STATUS — SEPARATE FROM MEDICINE AUTHORIZATIONWADA: LL-37 was not identified by exact name in the 2026 Prohibited List. Exact-name absencedoes not resolve S0: this review did not identify a current governmental approval for human
Authorization belongs to the named product, use, place, and date; sport status is independent.
بديل نصي
UNITED STATES
United States (FDA): Not approved for any indication
EU/EEA
European Union (EMA): Investigational; Phase 2 trials completed (LL-37001B, LL-37002)
UNITED KINGDOM
No UNITED KINGDOM row is present in the source status table
OTHER DOCUMENTED
Other jurisdictions: Status of synthetic products requires current national-register review; endogenous status is not product authorization

Sport status: WADA: LL-37 was not identified by exact name in the 2026 Prohibited List. Exact-name absence does not resolve S0: this review did not identify a current governmental approval for human therapeutic use, so athletes need a current, case-specific classification of the material and intended use.

Mechanism and pharmacology

LL-37 directly disrupts bacterial membranes (Gram-positive and Gram-negative), binds and neutralizes lipopolysaccharide (LPS), modulates immune responses by acting through formyl peptide receptors (FPR2/FPRL1), promotes wound re-epithelialization, angiogenesis, chemotaxis of immune cells, and reduces inflammation. It is produced by neutrophils, epithelial cells, keratinocytes, and other cell types. Post-secretory processing generates truncated peptides with varying antimicrobial and cytotoxic profiles. Its clinical application is limited by low proteolytic stability, dose-dependent cytotoxicity, and high production costs.

Evidence by claim

Claim/indicationStageGradeBest human evidenceMain resultImportant limitations
Venous leg ulcer healingPhase 2bBPhase 1/2 (n=34): topical LL-37 0.5 mg/mL twice weekly × 4 weeks6-fold higher healing rate constant vs (p=0.003); 68% mean area reduction at 0.5 mg/mLSmall trial; highest dose (3.2 mg/mL) showed no benefit
COVID-19 (oral LL-37)Phase 2CRCT (n=238): oral recombinant LL-37 in L. lactisReduced nucleic acid negative conversion time: 9.8 vs 14.0 days (p<0.01); single center; L. lactis delivery system
Antimicrobial activityDNone (human clinical)Broad-spectrum in vitro activity; MRSA wound infection models in miceNo human antimicrobial efficacy trial
Diabetic foot ulcersPreclinicalDNoneAnimal models onlyNo human data
درجات الأدلة
  • Aالدرجة A: مثبت لاستخدام محدد مصرح به
  • Bالدرجة B: أدلة بشرية معتدلة
  • Cالدرجة C: أدلة بشرية أولية
  • Dالدرجة D: ما قبل السريرية فقط
  • Eالدرجة E: ادعاء قصصي/تسويقي
  • Xالدرجة X: الأدلة تتعارض مع الادعاء أو لا تدعمه
تعرف على المزيد حول تصنيف الأدلة
Claim-evidence profile
LL-37 claim-evidence profileA: 0 claims; B: 1 claim; C: 1 claim; D: 2 claims; E: 0 claims; X: 0 claimsCONTRADICTORY / NON-SUPPORTIVEA — Established for a specific labeled useGrade A: Established for a specific labeled use — current approval plus adequate controlled trials and post-market context.0 claimsB — Moderate human evidenceGrade B: Moderate human evidence — multiple controlled studies or a strong pivotal study, but no current approval for the claim.1 claimVenous leg ulcer healingC — Preliminary human evidenceGrade C: Preliminary human evidence — small, uncontrolled, surrogate-endpoint, or early-phase studies.1 claimCOVID-19 (oral LL-37)D — Preclinical onlyGrade D: Preclinical only — in vitro or animal evidence with no adequate human efficacy evidence.2 claimsAntimicrobial activityDiabetic foot ulcersE — Anecdotal/marketing claimGrade E: Anecdotal/marketing claim — testimonials, extrapolation, or vendor claims without adequate scientific support.0 claimsX — Evidence contradicts or does not support the claimGrade X: Evidence contradicts or does not support the claim — adequate negative evidence, failed program, or claim inconsistent with the studied material.0 claims
This counts the page's claim rows; it does not average them into a score.
بديل نصي

Text alternative for the claim-evidence diagram. Each grade is defined below:

AEstablished for a specific labeled use
0 claims
BModerate human evidence
1 claim: Venous leg ulcer healing
CPreliminary human evidence
1 claim: COVID-19 (oral LL-37)
DPreclinical only
2 claims: Antimicrobial activity; Diabetic foot ulcers
EAnecdotal/marketing claim
0 claims
XEvidence contradicts or does not support the claim
0 claims
United StatesNot approved for any indication
EU/EEAInvestigational; Phase 2 trials completed (LL-37001B, LL-37002)
OtherStatus of synthetic products requires current national-register review; endogenous status is not product authorization

Key studies

StudyDesign/populationExposure studiedEndpoints and resultLimitations
LL-37001B (EudraCT 2012-002100-41)Phase 1/2, DBPC, n=34 hard-to-heal VLUTopical LL-37 0.5, 1.6, or 3.2 mg/mL twice weekly × 4 weeks6-fold healing rate increase at 0.5 mg/mL vs (p=0.003); 3.2 mg/mL no benefitSmall sample; dose-response inverted
LL-37002 (EudraCT 2018-000536-10)Phase 2b, DBPC, multicenter, n= VLU patientsLL-37 0.5 and 1.6 mg/mLComplete wound closure incidenceCompleted; full publication pending
Oral LL-37 COVID-19 2023 RCT, n=238, Omicron BA.5.1.3Oral recombinant LL-37 in L. lactisReduced NCT: 9.80 vs 14.04 days (p<0.01)Open-label; single center; platform delivery

Dose and administration evidence

Approved labeled regimen

None.

Studied regimens (not recommendations)

  • Topical (VLU): 0.5 mg/mL or 1.6 mg/mL LL-37 solution applied to wound bed (25 µL/cm²) every third day for 4 weeks.

  • Oral (COVID-19): recombinant LL-37 expressed in Lactococcus lactis, dosing per trial protocol.

What is not established

No established or recommended human dose.

Safety

Established label risks

None — no approved label.

Human-study signals

In the Phase 1/2 VLU trial (n=34), topical LL-37 was well tolerated with no systemic safety concerns or local tolerability issues. The most common AEs were mild and related to the wound itself. The Phase 2b trial and oral COVID-19 trial also reported no severe adverse events.

Unknowns and product-quality risks

  • LL-37 has dose-dependent cytotoxicity and hemolytic activity against eukaryotic cells in vitro at higher concentrations.

  • The inverted dose-response (no benefit at 3.2 mg/mL vs benefit at 0.5 mg/mL) warrants cautious dose selection.

  • Proteolytic instability limits formulation options.

  • Research-grade products lack pharmaceutical quality assurance.

  • PCAC review scheduled for February 2027.

Interactions and special populations

No drug-interaction studies. No safety data in pregnancy, lactation, or pediatric populations.

Regulatory, compounding, and sport notes

  • FDA: Not approved. Listed on the PCAC review agenda for February 2027 for compounding evaluation.

  • : LL-37 was not identified by exact name in the 2026 Prohibited List. Exact-name absence does not resolve : this review did not identify a current governmental approval for human therapeutic use, so athletes need a current, case-specific classification of the material and intended use.

  • No pharmaceutical product with LL-37 has received marketing authorization.

Evidence gaps

Search notes

  • Databases and registries: PubMed, ClinicalTrials.gov, EudraCT, UniProt, PubChem

  • Search terms: LL-37, cathelicidin, hCAP18, venous leg ulcer, antimicrobial peptide

  • Last searched: 2026-08-06

  • Inclusion emphasis: Controlled human trials; distinction from truncated analogs

Sources

أصوات الخبراء

ماذا يقول الخبراء

التعليقات آراء شخصية وليست جزءًا من مراجعة الأدلة؛ والإدراج لا يعني المصادقة.

لم يتم العثور على تعليقات خبراء موثقة لهذا المركب في المصادر التي يقبلها هذا الأطلس — الأدبيات المحكمة، واتصالات الجامعات والمستشفيات والجمعيات الطبية، والجهات التنظيمية، والصحافة العلمية الموقعة.

غياب التعليقات ليس دلياً على المركب بأي من الاتجاهين.

ادعاءات البائعين والعيادات ووسائل التواصل الاجتماعي مستبعدة بموجب السياسة ولا تُحتسب كتعليقات.

لم يتم العثور على فيديوهات خبراء موثقة لهذا المركب في مصادر هذا الأطلس.

غياب فيديوهات الخبراء ليس دلياً على المركب بأي من الاتجاهين.

فيديوهات البائعين ووسائل التواصل الاجتماعي مستبعدة بموجب السياسة ولا تُحتسب.

أسئلة

What is LL-37?

LL-37 is the only human cathelicidin, a 37-residue antimicrobial peptide encoded by the CAMP gene. It has broad-spectrum antimicrobial, immunomodulatory, and wound-healing activities. No LL-37 product has received regulatory approval. It is produced by neutrophils, epithelial cells, and keratinocytes.

Is LL-37 FDA-approved?

No. LL-37 is not FDA-approved for any indication. Phase 2 trials for venous leg ulcer healing have been completed but no Phase 3 trial has been conducted. FDA has listed LL-37 on the PCAC review agenda for February 2027 for 503A compounding evaluation.

What evidence exists for LL-37 and wound healing?

A Phase 1/2 RCT (n=34) of topical LL-37 in hard-to-heal venous leg ulcers reported a sixfold higher healing rate at the lowest concentration vs placebo (p=0.003), while the highest concentration tested showed no benefit. A Phase 2b trial has been completed with full publication pending. No established or recommended human dose.

What are LL-37's safety signals from human trials?

In the Phase 1/2 venous leg ulcer trial, topical LL-37 was well tolerated with no systemic safety concerns. However, LL-37 has dose-dependent cytotoxicity and hemolytic activity against eukaryotic cells in vitro at higher concentrations, and the inverted dose-response warrants cautious dose selection. No established or recommended human dose.

What evidence gaps remain for LL-37?

No Phase 3 trial has been completed for any indication. The inverted dose-response relationship observed in the VLU trial is not fully explained. Long-term safety is unknown. Systemic administration (IV, SC) has not been studied in controlled human trials. Delivery systems for oral and topical routes need optimization.

Is LL-37 prohibited in sport?

LL-37 was not identified by exact name in the 2026 WADA Prohibited List. However, this review did not identify a current governmental approval for human therapeutic use, so athletes should obtain a current, case-specific classification of the material and intended use.

تحديثات البحوث

انضم إلى الأطلس. واحصل على تحديثات الأدلة.

احصل على ملاحظات موجزة عندما تتغير أدلة الببتيد أو الحالة أو سجلات المصدر.