Le contenu des preuves est maintenu en anglais.

Bottom line

LL-37 is the only human cathelicidin, a 37-residue antimicrobial peptide encoded by the CAMP gene. It has broad-spectrum antimicrobial, immunomodulatory, and wound-healing activities. A Phase 1/2 RCT (LL-37001B, n=34) found topical LL-37 accelerated healing of hard-to-heal venous leg ulcers, with the lowest dose showing a sixfold healing rate improvement vs placebo. A Phase 2b trial (LL-37002) has been completed. No LL-37 product has received regulatory approval.

Identity and composition

FieldVerified information
Preferred nameLL-37
Key aliasesCathelicidin antimicrobial peptide, hCAP18, CAP-18, FALL-39, Ropocamptide
Molecular/sequence identity37-residue peptide: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Modifications/formC-terminal cleavage product of hCAP18; amphipathic α-helical conformation; MW ~4,493 Da
Stable identifiersUniProt P49913; PubChem CID 16198951; CAS 154947-66-7; ChEMBL530345; DrugBank DB16532
Identity caveatsActive form is cleaved from the 170-aa hCAP18 precursor. Truncated fragments (RK-31, KS-30, KR-20, FK-13, KR-12) occur naturally and have varying activities.

Development and approval status

JurisdictionStatus and indicationProduct/sourceAs of
United States (FDA)Not approved for any indicationN/A2026-08-06
European Union (EMA)Investigational; Phase 2 trials completed (LL-37001B, LL-37002)N/A2026-08-06
Other jurisdictionsStatus of synthetic products requires current national-register review; endogenous status is not product authorization2026-08-06

Mechanism and pharmacology

LL-37 directly disrupts bacterial membranes (Gram-positive and Gram-negative), binds and neutralizes lipopolysaccharide (LPS), modulates immune responses by acting through formyl peptide receptors (FPR2/FPRL1), promotes wound re-epithelialization, angiogenesis, chemotaxis of immune cells, and reduces inflammation. It is produced by neutrophils, epithelial cells, keratinocytes, and other cell types. Post-secretory processing generates truncated peptides with varying antimicrobial and cytotoxic profiles. Its clinical application is limited by low proteolytic stability, dose-dependent cytotoxicity, and high production costs.

Evidence by claim

Claim/indicationStageGradeBest human evidenceMain resultImportant limitations
Venous leg ulcer healingPhase 2bBPhase 1/2 RCT (n=34): topical LL-37 0.5 mg/mL twice weekly × 4 weeks6-fold higher healing rate constant vs placebo (p=0.003); 68% mean area reduction at 0.5 mg/mLSmall trial; highest dose (3.2 mg/mL) showed no benefit
COVID-19 (oral LL-37)Phase 2CRCT (n=238): oral recombinant LL-37 in L. lactisReduced nucleic acid negative conversion time: 9.8 vs 14.0 days (p<0.01)Open-label; single center; L. lactis delivery system
Antimicrobial activityPreclinicalDNone (human clinical)Broad-spectrum in vitro activity; MRSA wound infection models in miceNo human antimicrobial efficacy trial
Diabetic foot ulcersPreclinicalDNoneAnimal models onlyNo human data

Key studies

StudyDesign/populationExposure studiedEndpoints and resultLimitations
LL-37001B (EudraCT 2012-002100-41)Phase 1/2, DBPC, n=34 hard-to-heal VLUTopical LL-37 0.5, 1.6, or 3.2 mg/mL twice weekly × 4 weeks6-fold healing rate increase at 0.5 mg/mL vs placebo (p=0.003); 3.2 mg/mL no benefitSmall sample; dose-response inverted
LL-37002 (EudraCT 2018-000536-10)Phase 2b, DBPC, multicenter, n= VLU patientsLL-37 0.5 and 1.6 mg/mLComplete wound closure incidenceCompleted; full publication pending
Oral LL-37 COVID-19 RCT 2023Open-label RCT, n=238, Omicron BA.5.1.3Oral recombinant LL-37 in L. lactisReduced NCT: 9.80 vs 14.04 days (p<0.01)Open-label; single center; platform delivery

Dose and administration evidence

Approved labeled regimen

None.

Studied regimens (not recommendations)

  • Topical (VLU): 0.5 mg/mL or 1.6 mg/mL LL-37 solution applied to wound bed (25 µL/cm²) every third day for 4 weeks.

  • Oral (COVID-19): recombinant LL-37 expressed in Lactococcus lactis, dosing per trial protocol.

What is not established

No established or recommended human dose.

Safety

Established label risks

None — no approved label.

Human-study signals

In the Phase 1/2 VLU trial (n=34), topical LL-37 was well tolerated with no systemic safety concerns or local tolerability issues. The most common AEs were mild and related to the wound itself. The Phase 2b trial and oral COVID-19 trial also reported no severe adverse events.

Unknowns and product-quality risks

  • LL-37 has dose-dependent cytotoxicity and hemolytic activity against eukaryotic cells in vitro at higher concentrations.

  • The inverted dose-response (no benefit at 3.2 mg/mL vs benefit at 0.5 mg/mL) warrants cautious dose selection.

  • Proteolytic instability limits formulation options.

  • Research-grade products lack pharmaceutical quality assurance.

  • PCAC review scheduled for February 2027.

Interactions and special populations

No drug-interaction studies. No safety data in pregnancy, lactation, or pediatric populations.

Regulatory, compounding, and sport notes

  • FDA: Not approved. Listed on the PCAC review agenda for February 2027 for 503A compounding evaluation.

  • WADA: LL-37 was not identified by exact name in the 2026 Prohibited List. Exact-name absence does not resolve S0: this review did not identify a current governmental approval for human therapeutic use, so athletes need a current, case-specific classification of the material and intended use.

  • No pharmaceutical product with LL-37 has received marketing authorization.

Evidence gaps

  • No Phase 3 trial completed for any indication.

  • Dose-response relationship is unusual (inverted U-shape) and not fully explained.

  • Long-term safety unknown.

  • Systemic administration (IV, SC) has not been studied in controlled human trials.

  • Delivery systems for oral and topical routes need optimization.

Search notes

  • Databases and registries: PubMed, ClinicalTrials.gov, EudraCT, UniProt, PubChem

  • Search terms: LL-37, cathelicidin, hCAP18, venous leg ulcer, antimicrobial peptide

  • Last searched: 2026-08-06

  • Inclusion emphasis: Controlled human trials; distinction from truncated analogs

Sources

Questions

What is LL-37?

LL-37 is the only human cathelicidin, a 37-residue antimicrobial peptide encoded by the CAMP gene. It has broad-spectrum antimicrobial, immunomodulatory, and wound-healing activities. No LL-37 product has received regulatory approval. It is produced by neutrophils, epithelial cells, and keratinocytes.

Is LL-37 FDA-approved?

No. LL-37 is not FDA-approved for any indication. Phase 2 trials for venous leg ulcer healing have been completed but no Phase 3 trial has been conducted. FDA has listed LL-37 on the PCAC review agenda for February 2027 for 503A compounding evaluation.

What evidence exists for LL-37 and wound healing?

A Phase 1/2 RCT (n=34) found topical LL-37 at the lowest level tested accelerated hard-to-heal venous leg ulcer healing with a sixfold higher healing rate vs placebo (p=0.003). A Phase 2b trial has been completed with full publication pending. Notably, the highest level tested showed no benefit.

What are LL-37's safety signals from human trials?

In the Phase 1/2 venous leg ulcer trial, topical LL-37 was well tolerated with no systemic safety concerns. However, LL-37 has dose-dependent cytotoxicity and hemolytic activity against eukaryotic cells in vitro at higher concentrations, and the inverted dose-response warrants cautious dose selection.

Is LL-37 prohibited in sport?

LL-37 was not identified by exact name in the 2026 WADA Prohibited List. However, this review did not identify a current governmental approval for human therapeutic use, so athletes should obtain a current, case-specific classification of the material and intended use.

Mises à jour de la recherche

Rejoignez l'atlas. Obtenez les mises à jour des preuves.

Recevez des notes concises lorsque les preuves peptidiques, le statut ou les enregistrements sources changent.