साक्ष्य सामग्री अंग्रेजी में रखी जाती है।

Bottom line

"TB-500" is an ambiguous market label that refers to two chemically distinct molecules: (1) the defined synthetic heptapeptide Ac-LKKTETQ (CAS 885340-08-9, ~889 Da) — the N-acetylated actin-binding motif of thymosin beta-4, residues 17-23 — and (2) the full 43-amino-acid thymosin beta-4 protein (UniProt P62328, ~4,963 Da). Most vendor products labeled "TB-500" are the full-length protein. Neither form has any FDA-approved indication. Human-specific evidence for the heptapeptide is essentially absent. WADA classifies Tβ4 and its derivatives, including TB-500, as prohibited.

Identity and composition

FieldVerified information
Preferred nameTB-500
Key aliasesTB500, TB 500, Ac-LKKTETQ (heptapeptide); Thymosin beta-4, Tβ4, Timbetasin (full-length protein)
Molecular/sequence identityHeptapeptide: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln (Ac-LKKTETQ); Full protein: 43-aa SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Modifications/formHeptapeptide: N-acetylated; Full protein: N-acetylated
Stable identifiers (heptapeptide)PubChem CID 62707662; CAS 885340-08-9; UNII QHK6Z47GTG; formula C38H68N10O14; MW 889 Da
Stable identifiers (full protein)UniProt P62328; CAS 77591-33-4; PubChem CID 45382195; MW ~4,963 Da
Identity caveats"TB-500" names two distinct molecules differing ~5.6× in molecular weight. The heptapeptide is the actin-binding motif; the full protein is the parent Tβ4. Vendor labeling is inconsistent — verify against certificate of analysis before assuming identity.

Development and approval status

JurisdictionStatus and indicationProduct/sourceAs of
United States (FDA)Not approved for any indication. FDA lists "Thymosin beta-4, fragment (LKKTETQ), also known as TB-500" as a bulk drug substanceN/A2026-08-06
WADAProhibited under S2.3, which explicitly names thymosin-β4 and derivatives such as TB-500N/A2026-08-06
Other jurisdictionsStatus not established here; online research-chemical listings are not approvals2026-08-06

Mechanism and pharmacology

The heptapeptide LKKTETQ is the conserved actin-binding motif of thymosin beta-4. It binds monomeric G-actin and may influence actin polymerization dynamics. Full-length Tβ4 is the principal intracellular G-actin-sequestering peptide and also promotes angiogenesis, cell migration, and wound healing through multiple pathways including VEGF, PI3K/Akt/eNOS, and laminin-332 upregulation. Mechanistic literature overwhelmingly concerns the full-length protein, not the heptapeptide fragment. Human evidence specific to the heptapeptide is absent.

Evidence by claim

Claim/indicationStageGradeBest human evidenceMain resultImportant limitations
Wound healing (TB-500 heptapeptide)PreclinicalDNoneOne in vitro fibroblast wound-healing assay (metabolite Ac-LKKTE showed activity); no in vivo human dataAll evidence refers to full-length Tβ4 or in vitro fragment studies
Musculoskeletal recoveryPreclinicalDNoneAnimal models use full-length Tβ4, not the heptapeptideNo human evidence for heptapeptide
Tissue healing/regenerationPreclinicalDNoneScoping review: 70/80 studies used full-length Tβ4; only 1 direct TB-500 study (metabolite profiling)TB-500-specific evidence essentially absent

Key studies

StudyDesign/populationExposure studiedEndpoints and resultLimitations
Esposito et al. 2012Analytical chemistry; identified Ac-LKKTETQ in TB-500 productsN/AConfirmed heptapeptide identity in TB-500 samplesChemical analysis only; no biological or clinical data
Ho et al. 2012Doping control; LC-MS method for TB-500 detection in equine urine/plasmaN/AAnalytical method developmentNo efficacy or safety data
Scoping review (MDPI 2026)Literature mapping of TB4/TB-500 studiesn=80 studies70/80 on full-length Tβ4; 5 endogenous/derivative; 4 fragment; 1 direct TB-500Confirms near-total absence of human TB-500-specific data

Dose and administration evidence

Approved labeled regimen

None. Neither the heptapeptide nor full-length Tβ4 is approved for any indication.

Studied regimens (not recommendations)

No controlled human studies of the heptapeptide have been published. Dosing protocols promoted in unregulated markets are unsubstantiated.

What is not established

No established or recommended human dose.

Safety

Established label risks

None — no approved label.

Human-study signals

No controlled human safety data exist for the heptapeptide. Full-length Tβ4 ophthalmic safety data (from RGN-259 trials) do not apply to systemic or fragment use.

Unknowns and product-quality risks

  • Identity uncertainty is the primary risk: a vial labeled "TB-500" may contain either the 889 Da heptapeptide or the 4,963 Da full protein, with different properties and no interchangeable evidence base.

  • Products are unregulated research chemicals; purity, sterility, identity, and endotoxin are unverified.

  • FDA has identified the TB-500 fragment as a bulk substance that may present significant safety risks in compounding due to limited human exposure data.

  • WADA prohibits Tβ4 and derivatives.

Interactions and special populations

No data available for any population or drug class.

Regulatory, compounding, and sport notes

  • FDA: The heptapeptide (Ac-LKKTETQ) is on the FDA's list of bulk drug substances reviewed for compounding safety.

  • WADA: Prohibited under S2.3 (growth factors and growth-factor modulators) on the 2026 Prohibited List.

  • The heptapeptide and full-length Tβ4 are chemically distinct with separate CAS, UNII, and PubChem records. Regulatory documents must be read carefully to determine which entity is referenced.

  • No pharmaceutical-grade TB-500 exists; all supply is through unregulated research-chemical channels.

Evidence gaps

  • No human clinical trial of the defined heptapeptide exists for any indication.

  • No pharmacokinetic, dose-finding, or safety study in humans.

  • The literature base attributed to "TB-500" overwhelmingly concerns full-length Tβ4 and cannot be assumed to apply to the fragment.

  • Independent analytical testing of vendor "TB-500" products is limited; actual contents of marketed vials are poorly characterized.

Search notes

  • Databases and registries: PubMed, PubChem, FDA UNII, WADA Prohibited List, FDA Bulk Substances List

  • Search terms: TB-500, Ac-LKKTETQ, thymosin beta-4 fragment, TB500 doping

  • Last searched: 2026-08-06

  • Inclusion emphasis: Distinguishing heptapeptide from full-length Tβ4; prioritizing entity-specific evidence

Sources

  1. https://pubmed.ncbi.nlm.nih.gov/22962027/

  2. https://pubchem.ncbi.nlm.nih.gov/compound/62707662

  3. https://precision.fda.gov/uniisearch/srs/unii/QHK6Z47GTG

  4. https://www.mdpi.com/2076-3417/16/12/6202

  5. Rahaman KA, et al. Simultaneous quantification of TB-500 and its metabolites in in-vitro experiments and rats by UHPLC-Q-Exactive orbitrap MS/MS and their screening by wound healing activities in-vitro. J Chromatogr B. 2024;1235:124033. DOI 10.1016/j.jchromb.2024.124033. https://doi.org/10.1016/j.jchromb.2024.124033

  6. https://en.wikipedia.org/wiki/TB-500

  7. https://www.fda.gov/media/183892/download

प्रश्न

What is TB-500?

TB-500 is an ambiguous market label applied to two chemically distinct molecules: the synthetic heptapeptide Ac-LKKTETQ (about 889 Da) and the full 43-amino-acid thymosin beta-4 protein (about 4,963 Da). Most products sold under this name are the full-length protein. Neither form has any FDA-approved indication.

Is TB-500 approved by the FDA?

No. Neither the heptapeptide nor the full-length thymosin beta-4 protein is FDA-approved for any indication. FDA lists Thymosin beta-4 fragment (LKKTETQ), also known as TB-500, as a bulk drug substance reviewed for compounding safety. No pharmaceutical-grade TB-500 exists.

What human evidence exists for TB-500 for healing?

Human-specific evidence for the defined heptapeptide is essentially absent. A scoping review found that 70 of 80 studies used full-length thymosin beta-4, not the heptapeptide. No controlled human trial of TB-500 heptapeptide has been published for any claim, including wound healing or musculoskeletal recovery.

What are the risks of TB-500 identity confusion?

Identity uncertainty is the primary risk. A vial labeled TB-500 may contain either the 889 Da heptapeptide or the 4,963 Da full-length protein, with different properties and non-interchangeable evidence bases. FDA has noted the fragment may present significant safety risks due to limited human exposure data.

Is TB-500 prohibited by WADA?

Yes. WADA prohibits TB-500 under class S2.3 (growth factors and growth-factor modulators), which explicitly names thymosin-beta-4 and derivatives such as TB-500 on the 2026 Prohibited List.

अनुसंधान अद्यतन

एटलस से जुड़ें. साक्ष्य अद्यतन प्राप्त करें.

पेप्टाइड साक्ष्य, स्थिति, या स्रोत रिकॉर्ड बदलने पर संक्षिप्त नोट्स प्राप्त करें।