Konten bukti dipertahankan dalam bahasa Inggris.

Penggambaran struktur ideal untuk TB-500

Konformer ideal yang dibangun dari urutan; bukan struktur eksperimental atau prediksi.

Sekilas

ENTRY TYPE
boundary case
IDENTITY
Mixture/ambiguous — see identity

No structure asset recorded

TOP EVIDENCE
Grade D — Wound healing (TB-500 heptapeptide)
MAJOR STATUS
Jurisdiction-specific — see status table
SPORT
Prohibited — as of 2026-08-06
VERIFIED
2026-08-06

Bottom line

"TB-500" is an ambiguous market label that refers to two chemically distinct molecules: (1) the defined synthetic heptapeptide Ac-LKKTETQ (CAS 885340-08-9, ~889 Da) — the N-acetylated actin-binding motif of thymosin beta-4, residues 17-23 — and (2) the full 43-amino-acid thymosin beta-4 protein (UniProt P62328, ~4,963 Da). Most vendor products labeled "TB-500" are the full-length protein.

Neither form has any FDA-approved indication. Human-specific evidence for the heptapeptide is essentially absent. WADA classifies Tβ4 and its derivatives, including TB-500, as prohibited. See the getting-started guide for context on peptides.

Identity and composition

FieldVerified information
Preferred nameTB-500
Key aliasesTB500, TB 500, Ac-LKKTETQ (heptapeptide); Thymosin beta-4, Tβ4, Timbetasin (full-length protein)
Molecular/sequence identityHeptapeptide: Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln (Ac-LKKTETQ); Full protein: 43-aa SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Modifications/formHeptapeptide: N-acetylated; Full protein: N-acetylated
Stable identifiers (heptapeptide) 62707662; CAS 885340-08-9; UNII QHK6Z47GTG; formula C38H68N10O14; MW 889 Da
Stable identifiers (full protein)UniProt P62328; CAS 77591-33-4; PubChem CID 45382195; MW ~4,963 Da
Identity caveats"TB-500" names two distinct molecules differing ~5.6× in molecular weight. The heptapeptide is the actin-binding motif; the full protein is the parent Tβ4. Vendor labeling is inconsistent — verify against certificate of analysis before assuming identity.

Development and approval status

JurisdictionStatus and indicationProduct/sourceAs of
United States (FDA)Not approved for any indication. FDA lists "Thymosin beta-4, fragment (LKKTETQ), also known as TB-500" as a bulk drug substanceN/A2026-08-06
Prohibited under S2.3, which explicitly names thymosin-β4 and derivatives such as TB-500N/A2026-08-06
Other jurisdictionsStatus not established here; online research-chemical listings are not approvals2026-08-06
Status is multi-axis
TB-500 authorization and sport-status profileFour medicine-authorization axes reproduce only documented status rows; sport status is shown separately.UNITED STATESNot approved for anyindication. FDA lists "ThymosinSOURCE / AS OFROW 1 / 2026-08-06EU/EEASOURCE ROW OMITTEDSEE AUDIT REASONSOURCE / AS OFNOT PRESENT / NOT RECORDEDUNITED KINGDOMSOURCE ROW OMITTEDSEE AUDIT REASONSOURCE / AS OFNOT PRESENT / NOT RECORDEDOTHER DOCUMENTEDStatus not established here;online research-chemicalSOURCE / AS OFROW 3 / 2026-08-06SPORT STATUS — SEPARATE FROM MEDICINE AUTHORIZATIONProhibited under S2.3, which explicitly names thymosin-β4 and derivatives such as TB-500
Authorization belongs to the named product, use, place, and date; sport status is independent.
Alternatif teks
UNITED STATES
United States (FDA): Not approved for any indication. FDA lists "Thymosin beta-4, fragment (LKKTETQ), also known as TB-500" as a bulk drug substance
EU/EEA
No EU/EEA row is present in the source status table
UNITED KINGDOM
No UNITED KINGDOM row is present in the source status table
OTHER DOCUMENTED
Other jurisdictions: Status not established here; online research-chemical listings are not approvals

Sport status: Prohibited under S2.3, which explicitly names thymosin-β4 and derivatives such as TB-500

Mechanism and pharmacology

The heptapeptide fragment

The heptapeptide LKKTETQ is the conserved actin-binding motif of thymosin beta-4. It binds monomeric G-actin and may influence actin polymerization dynamics.

The full-length protein

Full-length Tβ4 is the principal intracellular G-actin-sequestering peptide and also promotes angiogenesis, cell migration, and wound healing through multiple pathways including VEGF, PI3K/Akt/eNOS, and laminin-332 upregulation.

Evidence boundary

Mechanistic literature overwhelmingly concerns the full-length protein, not the heptapeptide fragment. Human evidence specific to the heptapeptide is absent.

Evidence by claim

See the evidence grading methodology for an explanation of Grade letters.

Claim/indicationStageGradeBest human evidenceMain resultImportant limitations
Wound healing (TB-500 heptapeptide)DNoneOne in vitro fibroblast wound-healing assay (metabolite Ac-LKKTE showed activity); no in vivo human dataAll evidence refers to full-length Tβ4 or in vitro fragment studies
Musculoskeletal recoveryPreclinicalDNoneAnimal models use full-length Tβ4, not the heptapeptideNo human evidence for heptapeptide
Tissue healing/regenerationPreclinicalDNoneScoping review: 70/80 studies used full-length Tβ4; only 1 direct TB-500 study (metabolite profiling)TB-500-specific evidence essentially absent
Tingkat bukti
  • AKelas A: Mapan untuk penggunaan berlabel tertentu
  • BKelas B: Bukti manusia moderat
  • CKelas C: Bukti manusia awal
  • DKelas D: Hanya praklinis
  • EKelas E: Klaim anekdot/pemasaran
  • XKelas X: Bukti bertentangan atau tidak mendukung klaim
Pelajari lebih lanjut tentang penilaian bukti
Claim-evidence profile
TB-500 claim-evidence profileA: 0 claims; B: 0 claims; C: 0 claims; D: 3 claims; E: 0 claims; X: 0 claimsCONTRADICTORY / NON-SUPPORTIVEA — Established for a specific labeled useGrade A: Established for a specific labeled use — current approval plus adequate controlled trials and post-market context.0 claimsB — Moderate human evidenceGrade B: Moderate human evidence — multiple controlled studies or a strong pivotal study, but no current approval for the claim.0 claimsC — Preliminary human evidenceGrade C: Preliminary human evidence — small, uncontrolled, surrogate-endpoint, or early-phase studies.0 claimsD — Preclinical onlyGrade D: Preclinical only — in vitro or animal evidence with no adequate human efficacy evidence.3 claimsWound healing (TB-500 heptapeptide)Musculoskeletal recovery+1 moreE — Anecdotal/marketing claimGrade E: Anecdotal/marketing claim — testimonials, extrapolation, or vendor claims without adequate scientific support.0 claimsX — Evidence contradicts or does not support the claimGrade X: Evidence contradicts or does not support the claim — adequate negative evidence, failed program, or claim inconsistent with the studied material.0 claims
This counts the page's claim rows; it does not average them into a score. All claims: Wound healing (TB-500 heptapeptide); Musculoskeletal recovery; Tissue healing/regeneration.
Alternatif teks

Text alternative for the claim-evidence diagram. Each grade is defined below:

AEstablished for a specific labeled use
0 claims
BModerate human evidence
0 claims
CPreliminary human evidence
0 claims
DPreclinical only
3 claims: Wound healing (TB-500 heptapeptide); Musculoskeletal recovery; Tissue healing/regeneration
EAnecdotal/marketing claim
0 claims
XEvidence contradicts or does not support the claim
0 claims
United StatesNot approved for any indication. FDA lists "Thymosin beta-4, fragment (LKKTETQ), also known as TB-500" as a bulk drug substance
OtherStatus not established here; online research-chemical listings are not approvals

Key studies

StudyDesign/populationExposure studiedEndpoints and resultLimitations
Esposito et al. 2012Analytical chemistry; identified Ac-LKKTETQ in TB-500 productsN/AConfirmed heptapeptide identity in TB-500 samplesChemical analysis only; no biological or clinical data
Ho et al. 2012Doping control; LC-MS method for TB-500 detection in equine urine/plasmaN/AAnalytical method developmentNo efficacy or safety data
Scoping review (MDPI 2026)Literature mapping of TB4/TB-500 studiesn=80 studies70/80 on full-length Tβ4; 5 /derivative; 4 fragment; 1 direct TB-500Confirms near-total absence of human TB-500-specific data

Dose and administration evidence

Approved labeled regimen

None. Neither the heptapeptide nor full-length Tβ4 is approved for any indication.

Studied regimens (not recommendations)

No controlled human studies of the heptapeptide have been published. Dosing protocols promoted in unregulated markets are unsubstantiated.

What is not established

No established or recommended human dose.


Safety

Established label risks

None — no approved label.

Human-study signals

No controlled human safety data exist for the heptapeptide. Full-length Tβ4 ophthalmic safety data (from RGN-259 trials) do not apply to systemic or fragment use.

Unknowns and product-quality risks

  • Identity uncertainty is the primary risk: a vial labeled "TB-500" may contain either the 889 Da heptapeptide or the 4,963 Da full protein, with different properties and no interchangeable evidence base.

  • Products are unregulated research chemicals; purity, sterility, identity, and endotoxin are unverified.

  • FDA has identified the TB-500 fragment as a bulk substance that may present significant safety risks in compounding due to limited human exposure data.

  • prohibits Tβ4 and derivatives.

Interactions and special populations

No data available for any population or drug class.


Regulatory, compounding, and sport notes

  • FDA: The heptapeptide (Ac-LKKTETQ) is on the FDA's list of bulk drug substances reviewed for compounding safety. See the identity and structure assets methodology for how separating the two entities was verified.

  • WADA: Prohibited under S2.3 (growth factors and growth-factor modulators) on the 2026 Prohibited List. See the WADA and sport regulation brief.

  • The heptapeptide and full-length Tβ4 are chemically distinct with separate CAS, UNII, and PubChem CID records. Regulatory documents must be read carefully to determine which entity is referenced.

  • No pharmaceutical-grade TB-500 exists; all supply is through unregulated research-chemical channels.


Evidence gaps

  • No human clinical trial of the defined heptapeptide exists for any indication.

  • No , dose-finding, or safety study in humans.

  • The literature base attributed to "TB-500" overwhelmingly concerns full-length Tβ4 and cannot be assumed to apply to the fragment.

  • Independent analytical testing of vendor "TB-500" products is limited; actual contents of marketed vials are poorly characterized.

Search notes

  • Databases and registries: PubMed, PubChem, FDA UNII, Prohibited List, FDA Bulk Substances List

  • Search terms: TB-500, Ac-LKKTETQ, thymosin beta-4 fragment, TB500 doping

  • Last searched: 2026-08-06

  • Inclusion emphasis: Distinguishing heptapeptide from full-length Tβ4; prioritizing entity-specific evidence

Sources

  1. https://pubmed.ncbi.nlm.nih.gov/22962027/

  2. https://pubchem.ncbi.nlm.nih.gov/compound/62707662

  3. https://precision.fda.gov/uniisearch/srs/unii/QHK6Z47GTG

  4. https://www.mdpi.com/2076-3417/16/12/6202

  5. Rahaman KA, et al. Simultaneous quantification of TB-500 and its metabolites in in-vitro experiments and rats by UHPLC-Q-Exactive orbitrap MS/MS and their screening by wound healing activities in-vitro. J Chromatogr B. 2024;1235:124033. DOI 10.1016/j.jchromb.2024.124033. https://doi.org/10.1016/j.jchromb.2024.124033

  6. https://en.wikipedia.org/wiki/TB-500

  7. https://www.fda.gov/media/183892/download

Suara para ahli

Apa kata para ahli

Komentar adalah opini, bukan bagian dari tinjauan bukti; penyertaan bukan berarti dukungan.

Tidak ditemukan komentar ahli terverifikasi untuk senyawa ini dalam sumber yang diterima atlas ini — literatur tinjauan sejawat, komunikasi universitas, rumah sakit, dan perhimpunan medis, regulator, serta jurnalisme sains bernama.

Tidak adanya komentar bukanlah bukti tentang senyawa ini baik positif maupun negatif.

Klaim vendor, klinik, dan media sosial dikecualikan oleh kebijakan dan tidak dihitung sebagai komentar.

Video

Pertanyaan

What is TB-500?

TB-500 is an ambiguous market label applied to two chemically distinct molecules: the synthetic heptapeptide Ac-LKKTETQ (~889 Da) and the full 43-amino-acid thymosin beta-4 protein (~4,963 Da). Most products are the full-length protein. Seller labeling is inconsistent — identity must be verified against a certificate of analysis. Neither form has any FDA-approved indication.

Is TB-500 approved by the FDA?

No. Neither the heptapeptide nor the full-length Tβ4 protein is FDA-approved for any indication. The heptapeptide is listed as a bulk drug substance reviewed for compounding safety. No controlled human trial of TB-500 has been published for any claim; a scoping review found 70 of 80 studies used full-length Tβ4, not the heptapeptide, and human-specific evidence for the fragment is absent.

Is TB-500 prohibited by WADA?

Yes. WADA prohibits TB-500 under class S2.3 (growth factors and growth-factor modulators), which explicitly names thymosin-beta-4 and derivatives such as TB-500 on the 2026 Prohibited List. No pharmaceutical-grade TB-500 exists; all supply is through unregulated research-chemical channels.

Can evidence for thymosin beta-4 or other fragment derivatives be applied to TB-500?

No. The heptapeptide and full-length Tβ4 are chemically distinct with separate CAS, UNII, and PubChem records, differing ~5.6x in molecular weight. The literature base attributed to TB-500 overwhelmingly concerns full-length Tβ4 and cannot be assumed to apply to the fragment. Mechanistic literature on Tβ4 does not substitute for human evidence specific to the heptapeptide.

Why must TB-500 findings be matched to the exact claim?

No. All three evidence rows are graded D (preclinical only) — there is no human evidence for TB-500 heptapeptide for any claim. Claims for wound healing, musculoskeletal recovery, and tissue regeneration all rest on preclinical models, mostly using full-length Tβ4 rather than the heptapeptide. No grade A, B, or C human evidence supports any TB-500 use.

What remains unknown about TB-500?

Identity uncertainty is the primary risk. A vial labelled TB-500 may contain either the 889 Da heptapeptide or the 4,963 Da full-length protein, with different properties and non-interchangeable evidence bases. FDA has noted the fragment may present significant safety risks due to limited human exposure data.

Pembaruan penelitian

Bergabunglah dengan atlasnya. Dapatkan pembaruan bukti.

Terima catatan singkat ketika bukti peptida, status, atau catatan sumber berubah.